Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Outer dense fiber protein 4 (ODF4)

This Recombinant Human Outer dense fiber protein 4 (ODF4) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Outer dense fiber protein 4, Outer dense fiber of sperm tails protein 4, Testis-specific protein oppo 1, hOPPO1

UniProt

Q2M2E3

Expression Region

1-257

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTLSLSSNRSLGQ RQNSPLPFQWRITHSFRWMAQVLASELSLVAFILLLVVAFSKKWLDLSRSLFYQRWPVDV SNRIHTSAHVMSMGLLHFYKSRSCSDLENGKVTFIFSTLMLFPINIWIFELERNVSIPIG WSYFIGWLVLILYFTCAILCYFNHKSFWSLILSHPSGAVSCSSSFGSVEESPRAQTITDT PITQEGVLDPEQKDTHV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adenosine A1 Receptor (ADORA1) (NM_001048230) Human Over-expression Lysate
LC420792 20 µg

Adenosine A1 Receptor (ADORA1) (NM_001048230) Human Over-expression Lysate

Sign In for Pricing
View Details
Rho guanine exchange factor 15 (ARHGEF15) (NM_173728) Human Recombinant Protein
TP307435M 100 µg

Rho guanine exchange factor 15 (ARHGEF15) (NM_173728) Human Recombinant Protein

Sign In for Pricing
View Details
PCLAF Rabbit Polyclonal Antibody
TA366344 100 µL

PCLAF Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tdgf1 Mouse Gene Knockout Kit (CRISPR)
KN517364 1 Kit

Tdgf1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HOPX / HOD Recombinant Rabbit monoclonal Antibody
HA751349 100 µL

HOPX / HOD Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
1-Heptyne
TRC-H288200-5G 5 g

1-Heptyne

Sign In for Pricing
View Details