Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Outer dense fiber protein 4 (ODF4)

This Recombinant Human Outer dense fiber protein 4 (ODF4) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Outer dense fiber protein 4, Outer dense fiber of sperm tails protein 4, Testis-specific protein oppo 1, hOPPO1

UniProt

Q2M2E3

Expression Region

1-257

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTLSLSSNRSLGQ RQNSPLPFQWRITHSFRWMAQVLASELSLVAFILLLVVAFSKKWLDLSRSLFYQRWPVDV SNRIHTSAHVMSMGLLHFYKSRSCSDLENGKVTFIFSTLMLFPINIWIFELERNVSIPIG WSYFIGWLVLILYFTCAILCYFNHKSFWSLILSHPSGAVSCSSSFGSVEESPRAQTITDT PITQEGVLDPEQKDTHV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nrgn (NM_022029) Mouse Tagged ORF Clone
MG200121 10 µg

Nrgn (NM_022029) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
GAD65 Recombinant Chimeric Antibody Antibody
HA610289 100 µg

GAD65 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
IL12A Antibody
KC-468-01 50 μL

IL12A Antibody

Sign In for Pricing
View Details
IL12A Antibody
KC-468-02 100 µL

IL12A Antibody

Sign In for Pricing
View Details
IL12A Antibody
KC-468-03 1 mL

IL12A Antibody

Sign In for Pricing
View Details
Ttll9 Rabbit Polyclonal Antibody
TA363398 100 µL

Ttll9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details