Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Outer dense fiber protein 4 (ODF4)

This Recombinant Human Outer dense fiber protein 4 (ODF4) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Outer dense fiber protein 4, Outer dense fiber of sperm tails protein 4, Testis-specific protein oppo 1, hOPPO1

UniProt

Q2M2E3

Expression Region

1-257

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTLSLSSNRSLGQ RQNSPLPFQWRITHSFRWMAQVLASELSLVAFILLLVVAFSKKWLDLSRSLFYQRWPVDV SNRIHTSAHVMSMGLLHFYKSRSCSDLENGKVTFIFSTLMLFPINIWIFELERNVSIPIG WSYFIGWLVLILYFTCAILCYFNHKSFWSLILSHPSGAVSCSSSFGSVEESPRAQTITDT PITQEGVLDPEQKDTHV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK1 Recombinant Rabbit Monoclonal Antibody [SY26-02]
ET1607-51 100 µL

CDK1 Recombinant Rabbit Monoclonal Antibody [SY26-02]

Sign In for Pricing
View Details
Propargyl Bromide (Stablized with MgO)
TRC-P762575-50G 50 g

Propargyl Bromide (Stablized with MgO)

Sign In for Pricing
View Details
1110032F04Rik Mouse Gene Knockout Kit (CRISPR)
KN500023 1 Kit

1110032F04Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1-Acenaphthenone
TRC-A130755-250MG 250 mg

1-Acenaphthenone

Sign In for Pricing
View Details
PREB (NM_013388) Human Over-expression Lysate
LC402254 20 µg

PREB (NM_013388) Human Over-expression Lysate

Sign In for Pricing
View Details
BACH1 (NM_001186) Human Over-expression Lysate
LC400475 20 µg

BACH1 (NM_001186) Human Over-expression Lysate

Sign In for Pricing
View Details