Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Receptor expression-enhancing protein 4 (REEP4)

This Recombinant Pongo abelii Receptor expression-enhancing protein 4 (REEP4) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Receptor expression-enhancing protein 4

UniProt

Q5R598

Expression Region

1-257

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSWMICRLVVLVFGMLCPAYASYKAVKTKNIREYVRWMMYWIVFALFMAAEIITDIFIS WFPFYYEIKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDAYIVQAKERSYETVLS FGKRGLNIAASAAVQAATKSQGALAGRLRSFSMQDLRAIPDAPAPAYHDPLYLEDQVPHQ RPPIGYRAGGLQDSDTEDECWSDTEAVPRAPARPREKPLIRSQSLRVVKRKPPVREGTSR SLKVRTRKKTVPSDMDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

tert-Butyl 7'-Iodo-1',2'-dihydrospiro[azetidine-3,3'-indole]-1-carboxylate
TRC-B448565-250MG 250 mg

tert-Butyl 7'-Iodo-1',2'-dihydrospiro[azetidine-3,3'-indole]-1-carboxylate

Sign In for Pricing
View Details
FABP5 (Marker of Metastatic Potential in Colorectal Cancer) (CPTC-FABP5-3), CF640R conjugate, 0.1mg/mL
BNC402225-100 1x 100 µL

FABP5 (Marker of Metastatic Potential in Colorectal Cancer) (CPTC-FABP5-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NUCKS1 Antibody
8C17139-AAT 50 µg

NUCKS1 Antibody

Sign In for Pricing
View Details
CDC23 Rabbit Polyclonal Antibody
TA365611 100 µL

CDC23 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Benzotriazol-1-yl-oxytripyrrolidinphosphonium Hexafluorophosphate
TRC-B207500-25G 25 g

Benzotriazol-1-yl-oxytripyrrolidinphosphonium Hexafluorophosphate

Sign In for Pricing
View Details
MCM7 (Proliferation Marker) (MCM7/1468), CF594 conjugate, 0.1mg/mL
BNC941468-100 1x 100 µL

MCM7 (Proliferation Marker) (MCM7/1468), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details