Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Receptor expression-enhancing protein 4 (REEP4)

This Recombinant Pongo abelii Receptor expression-enhancing protein 4 (REEP4) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Receptor expression-enhancing protein 4

UniProt

Q5R598

Expression Region

1-257

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSWMICRLVVLVFGMLCPAYASYKAVKTKNIREYVRWMMYWIVFALFMAAEIITDIFIS WFPFYYEIKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDAYIVQAKERSYETVLS FGKRGLNIAASAAVQAATKSQGALAGRLRSFSMQDLRAIPDAPAPAYHDPLYLEDQVPHQ RPPIGYRAGGLQDSDTEDECWSDTEAVPRAPARPREKPLIRSQSLRVVKRKPPVREGTSR SLKVRTRKKTVPSDMDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acetophenazine Dimaleate
TRC-A163930-1G 1 g

Acetophenazine Dimaleate

Sign In for Pricing
View Details
LOC136242 (PRSS37) (NM_001008270) Human Over-expression Lysate
LY423410 100 µg

LOC136242 (PRSS37) (NM_001008270) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS809495 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Hydroxymalonic Acid
TRC-H531550-50MG 50 mg

Hydroxymalonic Acid

Sign In for Pricing
View Details
CD44v4 (Marker of Tumor Metastasis) (rCD44v4/1219), Biotin conjugate, 0.1mg/mL
BNCB1932-500 1x 500 µL

CD44v4 (Marker of Tumor Metastasis) (rCD44v4/1219), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD21 Antibody[HI21a]
E-AB-F1320G-01 20 Tests

PE/Cyanine5 Anti-Human CD21 Antibody[HI21a]

Sign In for Pricing
View Details