Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Receptor expression-enhancing protein 4 (REEP4)

This Recombinant Pongo abelii Receptor expression-enhancing protein 4 (REEP4) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Receptor expression-enhancing protein 4

UniProt

Q5R598

Expression Region

1-257

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSWMICRLVVLVFGMLCPAYASYKAVKTKNIREYVRWMMYWIVFALFMAAEIITDIFIS WFPFYYEIKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDAYIVQAKERSYETVLS FGKRGLNIAASAAVQAATKSQGALAGRLRSFSMQDLRAIPDAPAPAYHDPLYLEDQVPHQ RPPIGYRAGGLQDSDTEDECWSDTEAVPRAPARPREKPLIRSQSLRVVKRKPPVREGTSR SLKVRTRKKTVPSDMDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

7-(2-Hydroxy-3-(isopropylamino)propoxy)-2,3-dihydro-1H-inden-1-one
TRC-H853920-25MG 25 mg

7-(2-Hydroxy-3-(isopropylamino)propoxy)-2,3-dihydro-1H-inden-1-one

Sign In for Pricing
View Details
Mouse Samt4 activation kit by CRISPRa
GA210124 1 Kit

Mouse Samt4 activation kit by CRISPRa

Sign In for Pricing
View Details
CEP27 (HAUS2) (NM_001130447) Human Over-expression Lysate
LY427213 100 µg

CEP27 (HAUS2) (NM_001130447) Human Over-expression Lysate

Sign In for Pricing
View Details
Collagen VI α1 Antibody
8C12204-AAT 50 µg

Collagen VI α1 Antibody

Sign In for Pricing
View Details
HRP-streptavidin conjugate
16920-AAT 1 mg

HRP-streptavidin conjugate

Sign In for Pricing
View Details
Cd68 (NM_001031638) Rat Recombinant Protein
TP701401 50 µg

Cd68 (NM_001031638) Rat Recombinant Protein

Sign In for Pricing
View Details