Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida glabrata Translocation protein SEC62 (SEC62)

This Recombinant Candida glabrata Translocation protein SEC62 (SEC62) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Translocation protein SEC62

UniProt

Q6FRU9

Expression Region

1-257

Origin

Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDQSAVLAIASFVRNRSELKARKGLFQDKPTDFFRYKRFVRCLKSDAYKKKSLKQPDLYP PLPEDEEKFAELARGIFVEFIKNQLVVPGQKLHSYECKEHGLKPSKDYPHLIMSTKATLD DNEYYLWHYNPKTLTDYLIVFGVIGVILAFVCYPLWPASMRRGTYYLSLAAFGFLGVFFG VAIIRLIVFLISMLFIREKGGFWLFPNLFEDCGFFDSFKPLYGFGDKETYTYIKKMKKQK KRQAKKEKLKKLKEKAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human DLST/OGDC-E2 Protein, C-Strep
orb2832485-01 20 µg

Recombinant Human DLST/OGDC-E2 Protein, C-Strep

Sign In for Pricing
View Details
Recombinant Human DLST/OGDC-E2 Protein, C-Strep
orb2832485-02 50 µg

Recombinant Human DLST/OGDC-E2 Protein, C-Strep

Sign In for Pricing
View Details
Recombinant Human DLST/OGDC-E2 Protein, C-Strep
orb2832485-03 100 µg

Recombinant Human DLST/OGDC-E2 Protein, C-Strep

Sign In for Pricing
View Details
Anti-CD37/TSPAN26 (BI 836826) Biosimilar (Monoclonal, IgG)
A135862 100 µL

Anti-CD37/TSPAN26 (BI 836826) Biosimilar (Monoclonal, IgG)

Sign In for Pricing
View Details
BCL3 Rabbit Polyclonal Antibody (FITC)
orb2602708 100 µg

BCL3 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
KWE Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV730755 1.0 µg DNA

KWE Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details