Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Receptor expression-enhancing protein 4 (Reep4)

This Recombinant Mouse Receptor expression-enhancing protein 4 (Reep4) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Receptor expression-enhancing protein 4

UniProt

Q8K072

Expression Region

1-257

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSWMICRLVVLIFGMLYPAYASYKAVKSKNIREYVRWMMYWIVFAIFMAAETFTDIFIS WFPFYYEFKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDACIVQAKERSYETMLS FGKRSLNIAASAAVQAATKSQGALAGRLRSFSMQDLRSIPDTPVPTYQDPLYLEDQVPRR RPPIGYRPGGLQGSDTEDECWSDNEIVPQPPVRPREKPLGRSQSLRVVKRKPLTREGTSR SLKVRTRKKAMPSDMDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELF1 discontinued
509110 100 µg

ELF1 discontinued

Sign In for Pricing
View Details
Polyclonal ACVR1 Antibody
APR14808G 0.1 mg

Polyclonal ACVR1 Antibody

Sign In for Pricing
View Details
At4g18823 Antibody
orb787508 2 mg

At4g18823 Antibody

Sign In for Pricing
View Details
PRRT4 CRISPRa sgRNA lentivector (set of three targets)(Human)
37824121 3x 1.0µg DNA

PRRT4 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
NRAMP 1 (E-2)
sc-398077 200 µg/mL

NRAMP 1 (E-2)

Sign In for Pricing
View Details
AFAP1L2 Protein Lysate (Mouse) with C-HA Tag
11476034 100 µg

AFAP1L2 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details