Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Receptor expression-enhancing protein 4 (Reep4)

This Recombinant Mouse Receptor expression-enhancing protein 4 (Reep4) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Receptor expression-enhancing protein 4

UniProt

Q8K072

Expression Region

1-257

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSWMICRLVVLIFGMLYPAYASYKAVKSKNIREYVRWMMYWIVFAIFMAAETFTDIFIS WFPFYYEFKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDACIVQAKERSYETMLS FGKRSLNIAASAAVQAATKSQGALAGRLRSFSMQDLRSIPDTPVPTYQDPLYLEDQVPRR RPPIGYRPGGLQGSDTEDECWSDNEIVPQPPVRPREKPLGRSQSLRVVKRKPLTREGTSR SLKVRTRKKAMPSDMDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Danio rerio Opsin-1, short-wave-sensitive 1 (opn1sw1)
orb2905729-01 20 µg

Recombinant Danio rerio Opsin-1, short-wave-sensitive 1 (opn1sw1)

Sign In for Pricing
View Details
Recombinant Danio rerio Opsin-1, short-wave-sensitive 1 (opn1sw1)
orb2905729-02 100 µg

Recombinant Danio rerio Opsin-1, short-wave-sensitive 1 (opn1sw1)

Sign In for Pricing
View Details
LIMK1 Antibody
orb679288 100 µL

LIMK1 Antibody

Sign In for Pricing
View Details
Recombinant Human IGF2BP1 Protein, N-His
bs-103454P-01 20 µg

Recombinant Human IGF2BP1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human IGF2BP1 Protein, N-His
bs-103454P-02 50 µg

Recombinant Human IGF2BP1 Protein, N-His

Sign In for Pricing
View Details
KN-93 phosphate 100mg
A22229-100 100 mg

KN-93 phosphate 100mg

Sign In for Pricing
View Details