Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Suncus murinus Type I iodothyronine deiodinase (DIO1)

This Recombinant Suncus murinus Type I iodothyronine deiodinase (DIO1) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Type I iodothyronine deiodinase, EC= 1.97.1.10, 5DI, DIOI, Type 1 DI, Type-I 5'-deiodinase

UniProt

Q95N00

Expression Region

1-257

Origin

Suncus murinus (Asian house shrew) (Musk shrew)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLPGLGLLLKRFGVLVRVALKVAVGKVLLTLWPSAIRPHLLAMSEKTGMAKNPRFTYED WAPTFFSTQYFWFVLKVNWQQLEDRTKQGDIAPDSPVVHLSGQRARLWDFMQGNRPLVLN FGSCSUPSFLFKFDQFKRLVEDFSSVADFLTVYIEEAHASDGWAFKNNVDIRRHRDLQER LQAARLLLDRNPGCPVVVDTMENRSSQLYAALPERLYVLQEGRILYKGGPGPWNYHPEEV HAVLEQLCRSSAQSPRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL
BNC470003-100 1x 100 µL

CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL
BNC680806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL
BNC470178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF647 conjugate, 0.1mg/mL
BNC472216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF568 conjugate, 0.1mg/mL
BNC680160-500 1x 500 µL

CD20 (B9E9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF568 conjugate, 0.1mg/mL
BNC680009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details