Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Receptor expression-enhancing protein 4 (REEP4)

This Recombinant Human Receptor expression-enhancing protein 4 (REEP4) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Receptor expression-enhancing protein 4

UniProt

Q9H6H4

Expression Region

1-257

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSWMICRLVVLVFGMLCPAYASYKAVKTKNIREYVRWMMYWIVFALFMAAEIVTDIFIS WFPFYYEIKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDAYIVQAKERSYETVLS FGKRGLNIAASAAVQAATKSQGALAGRLRSFSMQDLRSISDAPAPAYHDPLYLEDQVSHR RPPIGYRAGGLQDSDTEDECWSDTEAVPRAPARPREKPLIRSQSLRVVKRKPPVREGTSR SLKVRTRKKTVPSDVDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Fhit shRNA (UAS) - Lentiviral mouse Fhit shRNA (UAS, RFP) (100)
GTR15244572 1 Vial

Lentiviral mouse Fhit shRNA (UAS) - Lentiviral mouse Fhit shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Active Annexin A2 (ANXA2)
TRV-0005308-01 10 µg

Active Annexin A2 (ANXA2)

Sign In for Pricing
View Details
Active Annexin A2 (ANXA2)
TRV-0005308-02 50 µg

Active Annexin A2 (ANXA2)

Sign In for Pricing
View Details
Active Annexin A2 (ANXA2)
TRV-0005308-03 100 µg

Active Annexin A2 (ANXA2)

Sign In for Pricing
View Details
Active Annexin A2 (ANXA2)
TRV-0005308-04 200 µg

Active Annexin A2 (ANXA2)

Sign In for Pricing
View Details
Active Annexin A2 (ANXA2)
TRV-0005308-05 500 µg

Active Annexin A2 (ANXA2)

Sign In for Pricing
View Details