Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Receptor expression-enhancing protein 4 (REEP4)

This Recombinant Human Receptor expression-enhancing protein 4 (REEP4) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Receptor expression-enhancing protein 4

UniProt

Q9H6H4

Expression Region

1-257

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSWMICRLVVLVFGMLCPAYASYKAVKTKNIREYVRWMMYWIVFALFMAAEIVTDIFIS WFPFYYEIKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDAYIVQAKERSYETVLS FGKRGLNIAASAAVQAATKSQGALAGRLRSFSMQDLRSISDAPAPAYHDPLYLEDQVSHR RPPIGYRAGGLQDSDTEDECWSDTEAVPRAPARPREKPLIRSQSLRVVKRKPPVREGTSR SLKVRTRKKTVPSDVDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ST3GAL1 shRNA (UAS) - Lentiviral human ST3GAL1 shRNA (UAS, iRFP) plasmid
GTR15092608 1 Vial

Lentiviral human ST3GAL1 shRNA (UAS) - Lentiviral human ST3GAL1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Alpk3 AAV siRNA Pooled Vector
11800164 1.0 µg

Alpk3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Coiled Coil Domain Containing Protein 80 (Biotin)
546067 200 µL

Coiled Coil Domain Containing Protein 80 (Biotin)

Sign In for Pricing
View Details
Bok sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4465203 1.0 µg DNA

Bok sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Recombinant X-Box Binding Protein 1 (XBP1)
SIPC445Hu01-01 10 µg

Recombinant X-Box Binding Protein 1 (XBP1)

Sign In for Pricing
View Details
Recombinant X-Box Binding Protein 1 (XBP1)
SIPC445Hu01-02 50 µg

Recombinant X-Box Binding Protein 1 (XBP1)

Sign In for Pricing
View Details