Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Receptor expression-enhancing protein 4 (REEP4)

This Recombinant Human Receptor expression-enhancing protein 4 (REEP4) spans the amino acid sequence from region 1-257.

Product Specifications

Product Name Alternative

Receptor expression-enhancing protein 4

UniProt

Q9H6H4

Expression Region

1-257

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSWMICRLVVLVFGMLCPAYASYKAVKTKNIREYVRWMMYWIVFALFMAAEIVTDIFIS WFPFYYEIKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDAYIVQAKERSYETVLS FGKRGLNIAASAAVQAATKSQGALAGRLRSFSMQDLRSISDAPAPAYHDPLYLEDQVSHR RPPIGYRAGGLQDSDTEDECWSDTEAVPRAPARPREKPLIRSQSLRVVKRKPPVREGTSR SLKVRTRKKTVPSDVDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4,5,6,7-Tetrahydro-7-oxo-benzo[b]thiophene-4-carboxylic Acid methyl Ester
433753-01 100 mg

4,5,6,7-Tetrahydro-7-oxo-benzo[b]thiophene-4-carboxylic Acid methyl Ester

Sign In for Pricing
View Details
4,5,6,7-Tetrahydro-7-oxo-benzo[b]thiophene-4-carboxylic Acid methyl Ester
433753-02 250 mg

4,5,6,7-Tetrahydro-7-oxo-benzo[b]thiophene-4-carboxylic Acid methyl Ester

Sign In for Pricing
View Details
ETP-45835 dihydrochloride
orb2802224-01 50 mg

ETP-45835 dihydrochloride

Sign In for Pricing
View Details
ETP-45835 dihydrochloride
orb2802224-02 10 mg

ETP-45835 dihydrochloride

Sign In for Pricing
View Details
Mouse GRB2-associated-binding protein 3, GAB3 ELISA Kit
MBS9329386-01 48 Well

Mouse GRB2-associated-binding protein 3, GAB3 ELISA Kit

Sign In for Pricing
View Details
Mouse GRB2-associated-binding protein 3, GAB3 ELISA Kit
MBS9329386-02 96 Well

Mouse GRB2-associated-binding protein 3, GAB3 ELISA Kit

Sign In for Pricing
View Details