Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RING finger protein 170 (RNF170)

This Recombinant Human RING finger protein 170 (RNF170) spans the amino acid sequence from region 1-258.

Product Specifications

Product Name Alternative

RING finger protein 170, Putative LAG1-interacting protein

UniProt

Q96K19

Expression Region

1-258

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKYQGEVQSLKLDDDSVIEGVSDQVLVAVVVSFALIATLVYALFRNVHQNIHPENQELV RVLREQLQTEQDAPAATRQQFYTDMYCPICLHQASFPVETNCGHLFCGACIIAYWRYGSW LGAISCPICRQTVTLLLTVFGEDDQSQDVLRLHQDINDYNRRFSGQPRSIMERIMDLPTL LRHAFREMFSVGGLFWMFRIRIILCLMGAFFYLISPLDFVPEALFGILGFLDDFFVIFLL LIYISIMYREVITQRLTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERCA3 (ATP2A3) Rabbit Polyclonal Antibody
TA367245 100 µL

SERCA3 (ATP2A3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ada Mouse Gene Knockout Kit (CRISPR)
KN500810 1 Kit

Ada Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS801001 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
1,5-Pentane-1,1,5,5-d4-diamine
TRC-P207700-5MG 5 mg

1,5-Pentane-1,1,5,5-d4-diamine

Sign In for Pricing
View Details
Chrna7 Mouse Gene Knockout Kit (CRISPR)
KN303310BN 1 Kit

Chrna7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Catenin, beta (CTNNB1) (CTNNB1/2030R), CF568 conjugate, 0.1mg/mL
BNC682030-500 1x 500 µL

Catenin, beta (CTNNB1) (CTNNB1/2030R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details