Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Peroxisomal membrane protein 11B (PEX11B)

This Recombinant Bovine Peroxisomal membrane protein 11B (PEX11B) spans the amino acid sequence from region 1-258.

Product Specifications

Product Name Alternative

Peroxisomal membrane protein 11B, Peroxin-11B, Peroxisomal biogenesis factor 11B

UniProt

Q148K5

Expression Region

1-258

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDAWVRFSAQSQARERLCRAAQYACSLLGHALQKHGASPELQKQIRQLEGHLSLGRKLLR LGNSADALESAKRAVHLSDVVLRFCITVSHLNRALYFACDNVLWAGKSGLAPRVDQEKWA QRSFRYYLFSLIMNLSRDAYEIRLLMEQESSACSRRLKGSGGVSGGIEPGGPGGPGIPGG GLPQVALKLRLRVLLLARVLRGHPPLLLDVVRNACDLFIPLDKLGLWRCGPGIVGLCGLV SSILSILTLICPWLRLKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Granulocyte-Colony Stimulating Factor (G-CSF) (CSF3) (CSF3/900), CF488A conjugate, 0.1mg/mL
BNC880900-100 1x 100 µL

Granulocyte-Colony Stimulating Factor (G-CSF) (CSF3) (CSF3/900), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Creatine Phosphokinase-BB (CK-BB) (CPTC-CKB-2), CF640R conjugate, 0.1mg/mL
BNC402233-500 1x 500 µL

Creatine Phosphokinase-BB (CK-BB) (CPTC-CKB-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Caldesmon (CALD1) Rabbit Polyclonal Antibody
AP06424PU-N 100 µg

Caldesmon (CALD1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human IGF2R Antibody Pair Set
E-KAB-0252 50 µL & 100 µg

Human IGF2R Antibody Pair Set

Sign In for Pricing
View Details
TMEM51 (NM_001136216) Human Over-expression Lysate
LC427856 20 µg

TMEM51 (NM_001136216) Human Over-expression Lysate

Sign In for Pricing
View Details
ADPRH (NM_001125) Human Over-expression Lysate
LC400452 20 µg

ADPRH (NM_001125) Human Over-expression Lysate

Sign In for Pricing
View Details