Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Peroxisomal membrane protein 11B (PEX11B)

This Recombinant Bovine Peroxisomal membrane protein 11B (PEX11B) spans the amino acid sequence from region 1-258.

Product Specifications

Product Name Alternative

Peroxisomal membrane protein 11B, Peroxin-11B, Peroxisomal biogenesis factor 11B

UniProt

Q148K5

Expression Region

1-258

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDAWVRFSAQSQARERLCRAAQYACSLLGHALQKHGASPELQKQIRQLEGHLSLGRKLLR LGNSADALESAKRAVHLSDVVLRFCITVSHLNRALYFACDNVLWAGKSGLAPRVDQEKWA QRSFRYYLFSLIMNLSRDAYEIRLLMEQESSACSRRLKGSGGVSGGIEPGGPGGPGIPGG GLPQVALKLRLRVLLLARVLRGHPPLLLDVVRNACDLFIPLDKLGLWRCGPGIVGLCGLV SSILSILTLICPWLRLKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIPI Antibody
8C16481-AAT 50 µg

LIPI Antibody

Sign In for Pricing
View Details
Human PCDHA6 activation kit by CRISPRa
GA111134 1 Kit

Human PCDHA6 activation kit by CRISPRa

Sign In for Pricing
View Details
MOSC1 (MARC1) (NM_022746) Human Recombinant Protein
TP303674M 100 µg

MOSC1 (MARC1) (NM_022746) Human Recombinant Protein

Sign In for Pricing
View Details
Human PRDM10 activation kit by CRISPRa
GA111315 1 Kit

Human PRDM10 activation kit by CRISPRa

Sign In for Pricing
View Details
Human SNAP25 Interacting Protein (SRCIN1) activation kit by CRISPRa
GA112955 1 Kit

Human SNAP25 Interacting Protein (SRCIN1) activation kit by CRISPRa

Sign In for Pricing
View Details
C18orf10 (TPGS2) Human Gene Knockout Kit (CRISPR)
KN420174 1 Kit

C18orf10 (TPGS2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details