Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Synapse differentiation-inducing gene protein 1-like (syndig1l)

This Recombinant Danio rerio Synapse differentiation-inducing gene protein 1-like (syndig1l) spans the amino acid sequence from region 1-258.

Product Specifications

Product Name Alternative

Synapse differentiation-inducing gene protein 1-like, Capucin, Transmembrane protein 90A

UniProt

Q5TZE2

Expression Region

1-258

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESLSELQNPLLDKNSKHMVMADYGYGGDFHSNQYQENIINYFVTGGGGGGGGGGGGGGV AVTGGNGKAKSQLLDATSLHLAVEAFYKPNFILYKDDVSGKGKDYKNECCETTFMEKKDK EVVVETPSTEDPQAKLLDENDVKIQTVSYEVEEEEYVEYETDCSSDSESEDNFIVIPPRD HLGLAIFSMLCCFWPLGIAAFYFSQGTSKAVTKGDFPLASIASRRALFLAALSITIGTGV YVGVVVALIAYLSKPGHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
BNC740204-500 1x 500 µL

Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF640R conjugate, 0.1mg/mL
BNC400994-500 1x 500 µL

TNF alpha (J2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL
BNC470177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL
BNC400391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL
BNC040525-100 1x 100 µL

CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (MUC1/520), CF488A conjugate, 0.1mg/mL
BNC880520-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (MUC1/520), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details