Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant CDP-diacylglycerol pyrophosphatase (cdh)

This Recombinant CDP-diacylglycerol pyrophosphatase (cdh) spans the amino acid sequence from region 1-258.

Product Specifications

Product Name Alternative

CDP-diacylglycerol pyrophosphatase, EC= 3.6.1.26, CDP-diacylglycerol phosphatidylhydrolase, CDP-diglyceride hydrolase

UniProt

Q8ZA34

Expression Region

1-258

Origin

Yersinia pestis

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSRSIKWRRYLLTLLILIILAAGLIYKLRFSNADALWKIISQQCIPHMTTEDDPRPCAEV NIPAGFAVLKDRNGPLQYLLIPTVPISGIESPQLLTATSPNYFADAWQARYFMAEKYGAP IDDTDISLAINSQYGRTQDQLHIHISCLKPQVKTALAAHSADFQQQWQPLPGGLLGHDYW VRRITATELQQPGPFHLLADEMPGAKEQMGRYGLAITALPSGDFLLLANKASLITQDRAS AEELQDHTCQVLPHLPVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL
BNC940050-500 1x 500 µL

IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF568 conjugate, 0.1mg/mL
BNC680178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calgranulin B / MRP-8/-14 / MAC 387 / S100A8/A9 / Macrophage Ag (MAC387), CF740 conjugate, 0.1mg/mL
BNC740035-100 1x 100 µL

Calgranulin B / MRP-8/-14 / MAC 387 / S100A8/A9 / Macrophage Ag (MAC387), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (rTGB24), CF640R conjugate, 0.1mg/mL
BNC401967-100 1x 100 µL

Thyroglobulin (Thyroidal Cell Marker) (rTGB24), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (Dendritic Cell Marker) (ITGAX/1284), CF405S conjugate, 0.1mg/mL
BNC041284-100 1x 100 µL

CD11c (Dendritic Cell Marker) (ITGAX/1284), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 1 (Suprabasal Keratinocyte Marker) (KRT1/1840), CF594 conjugate, 0.1mg/mL
BNC941840-500 1x 500 µL

Cytokeratin 1 (Suprabasal Keratinocyte Marker) (KRT1/1840), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details