Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein BEAN1 (BEAN1)

This Recombinant Human Protein BEAN1 (BEAN1) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Protein BEAN1, Brain-expressed protein associating with Nedd4 homolog, BEAN

UniProt

Q3B7T3

Expression Region

1-259

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFKRPCPLARYNRTSYFYPTFSESSEHSHLLVSPVLVASAVIGVVIILSCITIIVGSIR RDRQARLQRHRHRHHRHHHHHHHHRRRRHREYEHGYVSDEHTYSRSSRRMRYACSSSEDW PPPLDISSDGDVDATVLRELYPDSPPGYEECVGPGATQLYVPTDAPPPYSLTDSCPTLDG TSDSGSGHSPGRHQQEQRTPAQGGLHTVSMDTLPPYEAVCGAGPPSGLLPLPGPDPGPRG SQGSPTPTRAPASGPERIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PLD5 activation kit by CRISPRa
GA116335 1 Kit

Human PLD5 activation kit by CRISPRa

Sign In for Pricing
View Details
Cathepsin D (CTSD) Human Knockdown Lysate
LY300130 100 µg

Cathepsin D (CTSD) Human Knockdown Lysate

Sign In for Pricing
View Details
TEF1 (TEAD1) Human Gene Knockout Kit (CRISPR)
KN415492 1 Kit

TEF1 (TEAD1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1,1'-Diisooctyl Ester 2,2'-[(Dioctylstannylene)bis(thio)]bis-acetic Acid (Technical Grade)
TRC-D638870-500MG 500 mg

1,1'-Diisooctyl Ester 2,2'-[(Dioctylstannylene)bis(thio)]bis-acetic Acid (Technical Grade)

Sign In for Pricing
View Details
PE Anti-Human CD268 Antibody[11C1]
AN00316D-01 20 Tests

PE Anti-Human CD268 Antibody[11C1]

Sign In for Pricing
View Details
PE Anti-Human CD268 Antibody[11C1]
AN00316D-02 100 Tests

PE Anti-Human CD268 Antibody[11C1]

Sign In for Pricing
View Details