Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJECL38 (MJECL38)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJECL38 (MJECL38) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Uncharacterized protein MJECL38

UniProt

Q60293

Expression Region

1-259

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANMQSLTNIEVQRFHDCEWEYFKEFDDEFNKLWNEIEKTLGRDFINYLSAYFQKNLVYM LGKEFKLKLVVDTNIIFSQVLSYVTKGELPWILDFINNPFIELYAPQLIVDELKNKIENV LPKKCKKKNIDENKAKSKAIKIANIILSNIKIINDKKSNNWSKIAYNLIGHRDVKDIPFV TLALSLDTHGIITRDKDFKDQKIIKIWKVGEVKVVLTELSQGSFSFCIMNVTAPLAFKIC TSIIITILEIVTSIIKKTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTNNB1 Rabbit Polyclonal Antibody
E53P03670 100 µL

CTNNB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ACVR1B, ID (Activin Receptor Type-1B, Activin Receptor Type IB, Serine/Threonine-protein Kinase Receptor R2, SKR2, Activin Receptor-like Kinase 4, ACVRLK4, ALK4) (FITC)
MBS6461337-01 0.2 mL

ACVR1B, ID (Activin Receptor Type-1B, Activin Receptor Type IB, Serine/Threonine-protein Kinase Receptor R2, SKR2, Activin Receptor-like Kinase 4, ACVRLK4, ALK4) (FITC)

Sign In for Pricing
View Details
ACVR1B, ID (Activin Receptor Type-1B, Activin Receptor Type IB, Serine/Threonine-protein Kinase Receptor R2, SKR2, Activin Receptor-like Kinase 4, ACVRLK4, ALK4) (FITC)
MBS6461337-02 5x 0.2 mL

ACVR1B, ID (Activin Receptor Type-1B, Activin Receptor Type IB, Serine/Threonine-protein Kinase Receptor R2, SKR2, Activin Receptor-like Kinase 4, ACVRLK4, ALK4) (FITC)

Sign In for Pricing
View Details
CRY2 Mouse mAb
E47M51684 100 µL

CRY2 Mouse mAb

Sign In for Pricing
View Details
Lentiviral mouse Lmntd1 shRNA (UAS) - Lentiviral mouse Lmntd1 shRNA (UAS, RFP) (100)
GTR15239820 1 Vial

Lentiviral mouse Lmntd1 shRNA (UAS) - Lentiviral mouse Lmntd1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
RGD1309049 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6003305 3x 1.0 µg

RGD1309049 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details