Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJECL38 (MJECL38)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJECL38 (MJECL38) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Uncharacterized protein MJECL38

UniProt

Q60293

Expression Region

1-259

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANMQSLTNIEVQRFHDCEWEYFKEFDDEFNKLWNEIEKTLGRDFINYLSAYFQKNLVYM LGKEFKLKLVVDTNIIFSQVLSYVTKGELPWILDFINNPFIELYAPQLIVDELKNKIENV LPKKCKKKNIDENKAKSKAIKIANIILSNIKIINDKKSNNWSKIAYNLIGHRDVKDIPFV TLALSLDTHGIITRDKDFKDQKIIKIWKVGEVKVVLTELSQGSFSFCIMNVTAPLAFKIC TSIIITILEIVTSIIKKTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Benzoylpiperidine Hydrochloride
TRC-B208700-50MG 50 mg

4-Benzoylpiperidine Hydrochloride

Sign In for Pricing
View Details
HOMER2 (NM_199330) Human Untagged Clone
SC307935 10 µg

HOMER2 (NM_199330) Human Untagged Clone

Sign In for Pricing
View Details
GC Column, H3-17, 30m*0.25mm*0.25um, 1pc/pk
14051158 1 PC

GC Column, H3-17, 30m*0.25mm*0.25um, 1pc/pk

Sign In for Pricing
View Details
1-Butyl-4-methylpyridinium hexafluorophosphate
IL-0084-HP-1000 1 Kg

1-Butyl-4-methylpyridinium hexafluorophosphate

Sign In for Pricing
View Details
NPL2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1446608 1.0 µg DNA

NPL2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Phospho-IKKγ-S376 Rabbit pAb
E45R29340N-50 50 µL

Phospho-IKKγ-S376 Rabbit pAb

Sign In for Pricing
View Details