Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Peroxisomal membrane protein 11B (PEX11B)

This Recombinant Pongo abelii Peroxisomal membrane protein 11B (PEX11B) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Peroxisomal membrane protein 11B, Peroxin-11B, Peroxisomal biogenesis factor 11B, Protein PEX11 homolog beta, PEX11-beta

UniProt

Q5RFI0

Expression Region

1-259

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDAWVRFSAQSQARERLCRAAQYACSLLGHVLQRHGASPELQKQIRQLESHLSLGRKLLR LGNSADALESAKRAVHLSDVVLRFCITVSHLNRALYFACDNVLWAGKSGLAPRVDQEKWA QRSFRYYLFSLIMNLSRDAYEIRLLMEQESSACSRRLKGSGGGVPGGSETGGLGGPGTPG GHLPQLALKLRLQVLLLARVLRGHPPLLLDVVRNACDLFIPLDKLGLWRCGPGIVGLCGL VSSILSILTLIYPWLRLKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD32a/FCGR2A Protein (167 His, His Tag)
PKSH030294-01 100 µg

Recombinant Human CD32a/FCGR2A Protein (167 His, His Tag)

Sign In for Pricing
View Details
Recombinant Human CD32a/FCGR2A Protein (167 His, His Tag)
PKSH030294-02 1 mg

Recombinant Human CD32a/FCGR2A Protein (167 His, His Tag)

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS800574 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
TRIM73 Human Gene Knockout Kit (CRISPR)
KN418773 1 Kit

TRIM73 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IL6 Human Gene Knockout Kit (CRISPR)
KN202078RB 1 Kit

IL6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
6-Acetyl-picolinic Acid Ethyl Ester
TRC-A192523-10MG 10 mg

6-Acetyl-picolinic Acid Ethyl Ester

Sign In for Pricing
View Details