Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Peroxisomal membrane protein 11B (PEX11B)

This Recombinant Pongo abelii Peroxisomal membrane protein 11B (PEX11B) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Peroxisomal membrane protein 11B, Peroxin-11B, Peroxisomal biogenesis factor 11B, Protein PEX11 homolog beta, PEX11-beta

UniProt

Q5RFI0

Expression Region

1-259

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDAWVRFSAQSQARERLCRAAQYACSLLGHVLQRHGASPELQKQIRQLESHLSLGRKLLR LGNSADALESAKRAVHLSDVVLRFCITVSHLNRALYFACDNVLWAGKSGLAPRVDQEKWA QRSFRYYLFSLIMNLSRDAYEIRLLMEQESSACSRRLKGSGGGVPGGSETGGLGGPGTPG GHLPQLALKLRLQVLLLARVLRGHPPLLLDVVRNACDLFIPLDKLGLWRCGPGIVGLCGL VSSILSILTLIYPWLRLKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Galanthaminone
TRC-G188550-5MG 5 mg

Galanthaminone

Sign In for Pricing
View Details
Butanoic Acid
TRC-B692235-250G 250 g

Butanoic Acid

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS629822 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
TLK2 Mouse Monoclonal Antibody [Clone ID: OTI2H2]
CF805492 100 µg

TLK2 Mouse Monoclonal Antibody [Clone ID: OTI2H2]

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS638159 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
MAD1 (MAD1L1) Rabbit Polyclonal Antibody
TA361306 100 µL

MAD1 (MAD1L1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details