Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Peroxisomal membrane protein 11B (PEX11B)

This Recombinant Pongo abelii Peroxisomal membrane protein 11B (PEX11B) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Peroxisomal membrane protein 11B, Peroxin-11B, Peroxisomal biogenesis factor 11B, Protein PEX11 homolog beta, PEX11-beta

UniProt

Q5RFI0

Expression Region

1-259

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDAWVRFSAQSQARERLCRAAQYACSLLGHVLQRHGASPELQKQIRQLESHLSLGRKLLR LGNSADALESAKRAVHLSDVVLRFCITVSHLNRALYFACDNVLWAGKSGLAPRVDQEKWA QRSFRYYLFSLIMNLSRDAYEIRLLMEQESSACSRRLKGSGGGVPGGSETGGLGGPGTPG GHLPQLALKLRLQVLLLARVLRGHPPLLLDVVRNACDLFIPLDKLGLWRCGPGIVGLCGL VSSILSILTLIYPWLRLKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(E)-3-[2-(7-Chloro-2-quinolinyl)ethenyl]benzaldehyde
TRC-C381390-1G 1 g

(E)-3-[2-(7-Chloro-2-quinolinyl)ethenyl]benzaldehyde

Sign In for Pricing
View Details
MIR887 Human qPCR Primer Pair (MI0005562)
HP300599 200 Reactions

MIR887 Human qPCR Primer Pair (MI0005562)

Sign In for Pricing
View Details
Ubiquitin (Autophagy Marker) (UBB/3143R), CF647 conjugate, 0.1mg/mL
BNC473143-500 1x 500 µL

Ubiquitin (Autophagy Marker) (UBB/3143R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/3055), CF740 conjugate, 0.1mg/mL
BNC743055-100 1x 100 µL

Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/3055), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Serine racemase (SRR) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D7]
TA500942BM 100 µL

Serine racemase (SRR) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D7]

Sign In for Pricing
View Details
Urea-13C
TRC-U822503-1G 1 g

Urea-13C

Sign In for Pricing
View Details