Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Protein YIF1B (Yif1b)

This Recombinant Rat Protein YIF1B (Yif1b) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Protein YIF1B, YIP1-interacting factor homolog B

UniProt

Q6PEC3

Expression Region

1-259

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHATGLAAPAGTPRLRKWPSKRRVPVSQPGMADPHQFFDDTSSAPSRGYGGQPSPGSLGY PTSSSEAAFLAAPMSNMAMAYGSSLAAQGKELVDKNIDRFIPVSKLKYYFAVDTVYVGKK LGLLVFPYLHQDWEVQYQQDTPVAPRFDINAPDLYIPAMAFITYILVAGLALGTQDRMIG GVLTGLLFGKIGYYLVLAWCCVSIFVFMIRTLRLKILAQAAAEGVPVRGARNQLRMYLTM AVAAAQPVLMYWLTFHLVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NGLY1 Human Gene Knockout Kit (CRISPR)
KN203447BN 1 Kit

NGLY1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(R)-1-Benzyl-3-Boc-Aminopiperidine
TRC-B630453-500MG 500 mg

(R)-1-Benzyl-3-Boc-Aminopiperidine

Sign In for Pricing
View Details
Catenin, beta (p120) (CTNNB1/2099), CF647 conjugate, 0.1mg/mL
BNC472099-100 1x 100 µL

Catenin, beta (p120) (CTNNB1/2099), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DEK (C-term) Rabbit Polyclonal Antibody
AP51234PU-N 400 µL

DEK (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cyanuric Chloride
TRC-C987695-5G 5 g

Cyanuric Chloride

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Human IgM,  10nm
GM-08-10 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human IgM, 10nm

Sign In for Pricing
View Details