Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Protein YIF1B (Yif1b)

This Recombinant Rat Protein YIF1B (Yif1b) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Protein YIF1B, YIP1-interacting factor homolog B

UniProt

Q6PEC3

Expression Region

1-259

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHATGLAAPAGTPRLRKWPSKRRVPVSQPGMADPHQFFDDTSSAPSRGYGGQPSPGSLGY PTSSSEAAFLAAPMSNMAMAYGSSLAAQGKELVDKNIDRFIPVSKLKYYFAVDTVYVGKK LGLLVFPYLHQDWEVQYQQDTPVAPRFDINAPDLYIPAMAFITYILVAGLALGTQDRMIG GVLTGLLFGKIGYYLVLAWCCVSIFVFMIRTLRLKILAQAAAEGVPVRGARNQLRMYLTM AVAAAQPVLMYWLTFHLVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome P450 4F2 Antibody
8C12283-AAT 50 µg

Cytochrome P450 4F2 Antibody

Sign In for Pricing
View Details
Drying Oven BODR-302
BODR-302 1 Unit

Drying Oven BODR-302

Sign In for Pricing
View Details
Nordazepam
TRC-D291595-5MG 5 mg

Nordazepam

Sign In for Pricing
View Details
Tide Fluor™ 4 maleimide [TF4 maleimide] *Superior replacement for ROX and Texas Red*
2287-AAT 1 mg

Tide Fluor™ 4 maleimide [TF4 maleimide] *Superior replacement for ROX and Texas Red*

Sign In for Pricing
View Details
ADAMTS8 Rabbit Polyclonal Antibody
TA367532 100 µL

ADAMTS8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human CD72 Protein, Mouse IgG2a Fc Tag (MALS verified)
CD2-H5255-100ug 100 µg

Human CD72 Protein, Mouse IgG2a Fc Tag (MALS verified)

Sign In for Pricing
View Details