Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Sphingoid base hydroxylase 2 (SBH2)

This Recombinant Arabidopsis thaliana Sphingoid base hydroxylase 2 (SBH2) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Sphingoid base hydroxylase 2, EC= 1.14.-.-, Sphingoid C4-hydroxylase 2

UniProt

Q9AST3

Expression Region

1-259

Origin

Arabidopsis thaliana (Mouse-ear cress)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMSFVISDEFLGTFVPILVYWVYSGMYICLGSLDKYRLHSKIDEDEKNLVSKSAVVKGVL LQQTLQAIISVILFKITGSDADAATTQQFSILLLARQFIIAMLVIDTWQYFIHRYMHLNK FLYKHIHSQHHRLIVPYSYGALYNHPLEGLLLDTIGGALSFLFSGMSPRTAIFFFSFATI KTVDDHCGLWLPGNPFHIFFSNNSAYHDVHHQLYGTKYNFSQPFFVMWDRILGTYLPYSL EKRANGGFETRPIKVSKDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF488A conjugate, 0.1mg/mL
BNC880645-100 1x 100 µL

FOXP3 (3G3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF647 conjugate, 0.1mg/mL
BNC471073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL
BNC040994-100 1x 100 µL

TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF740 conjugate, 0.1mg/mL
BNC740176-500 1x 500 µL

CD5 (Cris-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL
BNC040017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL
BNC680965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details