Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Emerin (Emd)

This Recombinant Mouse Emerin (Emd) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Emerin

UniProt

O08579

Expression Region

1-259

Origin

Mus musculus (Mouse)

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDDYAVLSDTELAAVLRQYNIPHGPIVGSTRKLYEKKIFEYETQRRRLLPPNSSSSSFSY QFSDLDSAAVDSDMYDLPKKEDALLYQSKDYNDDYYEESYLTTKTYGEPESVGMSKSFRQ PGTSLVDADTFHHQVRDDIFSSLEEEGKDRERLIYGQDSAYQSIAHYRPISNVSRSSLGL SYYPTSSTSSVSSSSSSPSSWLTRRAIRPEKQAPAAALGQDRQVPLWGQLLLFLVFAAFL LFVYYSIQAEEGNPFWMDP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX19B Protein Vector (Human) (pPB-C-His)
PV011941 500 ng

DDX19B Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Rabbit Monoclonal CD68/SR-D1 Antibody (C68/3709R) [Janelia Fluor 525]
NBP3-21053JF525 0.1 mL

Rabbit Monoclonal CD68/SR-D1 Antibody (C68/3709R) [Janelia Fluor 525]

Sign In for Pricing
View Details
Neodymium acetate hydrate, 99.9%
GX2428-250g 250 g

Neodymium acetate hydrate, 99.9%

Sign In for Pricing
View Details
Recombinant ASFV Pret-159 Protein (aa 1-233)
VAng-2448Lsx-1mg 1 mg

Recombinant ASFV Pret-159 Protein (aa 1-233)

Sign In for Pricing
View Details
Mouse CD1 Midbrain Total Protein
MT-217 0.1 mg

Mouse CD1 Midbrain Total Protein

Sign In for Pricing
View Details
ATG12 Antibody
MBS7124747-01 0.05 mL

ATG12 Antibody

Sign In for Pricing
View Details