Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Emerin (Emd)

This Recombinant Mouse Emerin (Emd) spans the amino acid sequence from region 1-259.

Product Specifications

Product Name Alternative

Emerin

UniProt

O08579

Expression Region

1-259

Origin

Mus musculus (Mouse)

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDDYAVLSDTELAAVLRQYNIPHGPIVGSTRKLYEKKIFEYETQRRRLLPPNSSSSSFSY QFSDLDSAAVDSDMYDLPKKEDALLYQSKDYNDDYYEESYLTTKTYGEPESVGMSKSFRQ PGTSLVDADTFHHQVRDDIFSSLEEEGKDRERLIYGQDSAYQSIAHYRPISNVSRSSLGL SYYPTSSTSSVSSSSSSPSSWLTRRAIRPEKQAPAAALGQDRQVPLWGQLLLFLVFAAFL LFVYYSIQAEEGNPFWMDP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DISP2 Rabbit Polyclonal Antibody
TA372422 100 µL

DISP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human SUB1, Rabbit Polyclonal
KB4150GNPAF Inquire

Anti-Human SUB1, Rabbit Polyclonal

Sign In for Pricing
View Details
[4- (3-Fluoro-4-methylphenyl) phenyl]acetic acid
428858-01 100 mg

[4- (3-Fluoro-4-methylphenyl) phenyl]acetic acid

Sign In for Pricing
View Details
[4- (3-Fluoro-4-methylphenyl) phenyl]acetic acid
428858-02 250 mg

[4- (3-Fluoro-4-methylphenyl) phenyl]acetic acid

Sign In for Pricing
View Details
Rat Mindy1 Pre-designed siRNA Set B
SI208449B 1 Each

Rat Mindy1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Lentiviral human DMTF1 shRNA (UAS) - Lentiviral human DMTF1 shRNA (UAS, GFP) (100)
GTR15131601 1 Vial

Lentiviral human DMTF1 shRNA (UAS) - Lentiviral human DMTF1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details