Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 106C (Tmem106c)

This Recombinant Mouse Transmembrane protein 106C (Tmem106c) spans the amino acid sequence from region 1-260.

Product Specifications

Product Name Alternative

Transmembrane protein 106C

UniProt

Q80VP8

Expression Region

1-260

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSQHSSALTFCQRKKDDNPEDLLADRDQEEAIAQFPYVEFTGRNSITCHTCQGAGYIPA EQVNELVALIPHSDQRLRPQRTKQYVLLSVLLCLLASGLVFFFLFPHSVLVDDNGIKVTK VTFNEQDSLVVLDVTATLKIRNSNFYPVAVTNLFSQVQYMKAVVGSYTTTNVSLIAPRSE HLVNFTVKAEVGGPSSYVYFYCTLPAIRVHNIVIFMRTSVKISYIGHISQSTLETQHYVD CGVNSTAAQSLFLVPRGPHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Magnetic Luminex Screening Assay
LXSAMSM-03 1 Kit

Mouse Magnetic Luminex Screening Assay

Sign In for Pricing
View Details
Foxred2 ORF Vector (Mouse) (pORF)
20804014 1.0 µg DNA

Foxred2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
ALKBH3 Protein Vector (Human) (pPM-C-HA)
11774021 500 ng

ALKBH3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
CPI-17 (PKC Potentiated Inhibitor Protein-17) (APC) discontinued
C7905-50-APC 100 µL

CPI-17 (PKC Potentiated Inhibitor Protein-17) (APC) discontinued

Sign In for Pricing
View Details
DIO2 Rabbit Polyclonal Antibody
TA351141 100 µL

DIO2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Neurotensin (Human, Bovine, Canine)
PNT-4029 25 mg

Neurotensin (Human, Bovine, Canine)

Sign In for Pricing
View Details