Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 111 (Tmem111)

This Recombinant Mouse Transmembrane protein 111 (Tmem111) spans the amino acid sequence from region 2-261.

Product Specifications

Product Name Alternative

Transmembrane protein 111

UniProt

Q99KI3

Expression Region

2-261

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AGPELLLDSNIRLWVVLPIVIITFFVGMIRHYVSILLQSDKKLTQEQVSDSQVLIRSRVL RENGKYIPKQSFLTRKYYFNNPEDGFFKKTKRKVVPPSPMTDPTMLTDMMKGNVTNVLPM ILIGGWINMTFSGFVTTKVPFPLTLRFKPMLQQGIELLTLDASWVSSASWYFLNVFGLRS IYSLILGQDNAADQSRMMQEQMTGAAMAMPADTNKAFKTEWEALELTDHQWALDDVEEEL MARDLHFEGMFKKELQTSIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tim23 Rabbit Polyclonal Antibody
HA500398 100 µL

Tim23 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Bovine IgG,  30nm
GAF-511-30 1 mL

Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Bovine IgG, 30nm

Sign In for Pricing
View Details
3,4-Diaminopyridine-d3
TRC-D415952-50MG 50 mg

3,4-Diaminopyridine-d3

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (CALD1/820 + h-CALD), CF647 conjugate, 0.1mg/mL
BNC470821-100 1x 100 µL

Caldesmon, HMW (h-Caldesmon) (CALD1/820 + h-CALD), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
5-Hydroxy Omeprazole Sodium Salt
TRC-H948863-2.5MG 2.5 mg

5-Hydroxy Omeprazole Sodium Salt

Sign In for Pricing
View Details
Btk Mouse Gene Knockout Kit (CRISPR)
KN502310 1 Kit

Btk Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details