Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 111 (Tmem111)

This Recombinant Mouse Transmembrane protein 111 (Tmem111) spans the amino acid sequence from region 2-261.

Product Specifications

Product Name Alternative

Transmembrane protein 111

UniProt

Q99KI3

Expression Region

2-261

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AGPELLLDSNIRLWVVLPIVIITFFVGMIRHYVSILLQSDKKLTQEQVSDSQVLIRSRVL RENGKYIPKQSFLTRKYYFNNPEDGFFKKTKRKVVPPSPMTDPTMLTDMMKGNVTNVLPM ILIGGWINMTFSGFVTTKVPFPLTLRFKPMLQQGIELLTLDASWVSSASWYFLNVFGLRS IYSLILGQDNAADQSRMMQEQMTGAAMAMPADTNKAFKTEWEALELTDHQWALDDVEEEL MARDLHFEGMFKKELQTSIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRLF3 Mouse Monoclonal Antibody [Clone ID: OTI2A10]
CF812346 100 µg

CRLF3 Mouse Monoclonal Antibody [Clone ID: OTI2A10]

Sign In for Pricing
View Details
Frozen Tissue Sections, Testis
CS633306 5x 5 µm

Frozen Tissue Sections, Testis

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR561461 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
Factor VII (F7) Human Gene Knockout Kit (CRISPR)
KN213143RB 1 Kit

Factor VII (F7) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NAGA Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8H7]
TA811279AM 100 µL

NAGA Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8H7]

Sign In for Pricing
View Details
Spinosad Impurity PSA(A)
TRC-S557795-25MG 25 mg

Spinosad Impurity PSA(A)

Sign In for Pricing
View Details