Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Uncharacterized transmembrane protein DDB_G0286729 (DDB_G0286729)

This Recombinant Dictyostelium discoideum Uncharacterized transmembrane protein DDB_G0286729 (DDB_G0286729) spans the amino acid sequence from region 1-261.

Product Specifications

Product Name Alternative

Uncharacterized transmembrane protein DDB_G0286729

UniProt

Q54LB5

Expression Region

1-261

Origin

Dictyostelium discoideum (Slime mold)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGVADNEYISVPTGEPVQQQPQTTSVVFGAPQSYYPHQQPQIILSAPTTTASTSTTDSTV VEENPVCCDRCDLENKVKYQRYSTVGPWLYQIIILFFSQQFLLFSIAPILGLFAMYTQNR CIVVMHFLTAAFYYIFSVIFLFSGDQINTILLSILFSIIFTLSLMNYSRYIKTLNKLANV GECLQSTINGSGFEVTIESQPTPTTIPQPIVQPQPIYVSQLPMMIPQPSSQPPQIIVPQI VYDANHNPIYHLIPIQNSNQH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
BNC740204-100 1x 100 µL

Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL
BNC040146-100 1x 100 µL

CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL
BNC942216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL
BNC400204-500 1x 500 µL

Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF647 conjugate, 0.1mg/mL
BNC470679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 5/6/18 (LP34), CF568 conjugate, 0.1mg/mL
BNC682036-100 1x 100 µL

Cytokeratin 5/6/18 (LP34), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details