Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Transmembrane protein 55B-B (tmem55bb)

This Recombinant Danio rerio Transmembrane protein 55B-B (tmem55bb) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Transmembrane protein 55B-B, EC= 3.1.3.-, PtdIns-4,5-P2 4-Ptase I-B, Type I phosphatidylinositol 4,5-bisphosphate 4-phosphatase-B

UniProt

Q66I51

Expression Region

1-262

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADGERSPLLLDGRDGMTGLSLGDEPYRPISKPQNFAVFPSAPPMLGEAPPPYSPLGSPE SSSAPVISCRVCQSLISVEGKIHQHVVKCGVCNEATPIKNAPAGKKYVRCPCNCLLICKV TSQRIACPRPYCKRVINLGPVNPGAGSPNPQPTGARVSCGHCAKTFLWTEFTDRTLARCP HCRKVSSIGQRYPRKRSLICFLLCLIFVITTAGLIAGTWLKAQKYKGIYASWVFFIVLVL VTLVRALHWACMKISEPLHNYS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD54 / ICAM-1 (15.2), CF740 conjugate, 0.1mg/mL
BNC742853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL
BNC040304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL
BNC741820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF647 conjugate, 0.1mg/mL
BNC471073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF770 conjugate, 0.1mg/mL
BNC700164-500 1x 500 µL

CD28 (204.12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 14 (KRT14) (Squamous Cell Marker) (KRT14/2375), CF647 conjugate, 0.1mg/mL
BNC472375-100 1x 100 µL

Cytokeratin 14 (KRT14) (Squamous Cell Marker) (KRT14/2375), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details