Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Catechol O-methyltransferase domain-containing protein 1 (Comtd1)

This Recombinant Mouse Catechol O-methyltransferase domain-containing protein 1 (Comtd1) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Catechol O-methyltransferase domain-containing protein 1, EC= 2.1.1.-

UniProt

Q8BIG7

Expression Region

1-262

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQPVPRLSIPAALALGSAALGAAFATGLLLGKRWPPWGSRRQERLLPPEDNPLWQYLLS RSMREHPALRSLRLLTLEQPQGDSMMTCEQAQLLANLARLIKAKKALDLGTFTGYSALAL ALALPEAGRVVTCEVDAEPPKLGRPMWKQAEVEQKIDLRLQPALQTLDELLAAGEAGTFD IAVVDADKENCTAYYERCLQLLRPGGVLAVLRVLWRGEVLQPQPRNKTVECVRNLNERIL RDARVYISLLPLDDGLSLAFKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human RAC1 protein (His tag)
PDEH100759-01 20 µg

Recombinant Human RAC1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human RAC1 protein (His tag)
PDEH100759-02 100 µg

Recombinant Human RAC1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human RAC1 protein (His tag)
PDEH100759-03 500 µg

Recombinant Human RAC1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human RAC1 protein (His tag)
PDEH100759-04 1 mg

Recombinant Human RAC1 protein (His tag)

Sign In for Pricing
View Details
Neamine Disulfate Salt
TRC-N386005-250MG 250 mg

Neamine Disulfate Salt

Sign In for Pricing
View Details
SOX8 Antibody
KC-21652-01 50 μL

SOX8 Antibody

Sign In for Pricing
View Details