Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg01090 (AtMg01090)

This Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg01090 (AtMg01090) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Uncharacterized mitochondrial protein AtMg01090, ORF262

UniProt

P92541

Expression Region

1-262

Origin

Arabidopsis thaliana (Mouse-ear cress)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYLLIVFLSMLSSSVAGFFGRFLGSESVSRFNLIIFLILLVFSICLFRSLKQYLGKRMTQ WCYLALVCQISLFLVLLRSHILAGFGTFSADVFTVFMGTFSVTGSSGGIVNHQDGASSEW FTYTSDMVEDSASSGRTSSSVNQPIPEEQAWEREARAQEHDRISAEVETITSACENLEAA MVRKAQILLHQRGVTLGDPEDVKRALQLALHDDWEHAIDDRKRHFTVLRRNFGTARCERW NPFIDELRGLGNHQVNARHYVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF740 conjugate, 0.1mg/mL
BNC741037-100 1x 100 µL

CD44 Standard (DF1485), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL
BNC400158-500 1x 500 µL

Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL
BNC740177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL
BNC401429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (B22.1), CF740 conjugate, 0.1mg/mL
BNC741219-100 1x 100 µL

Cytokeratin 8 (B22.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (JC/70A), CF405S conjugate, 0.1mg/mL
BNC040639-100 1x 100 µL

CD31 / PECAM-1 (JC/70A), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details