Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Quinol oxidase subunit 2 (qoxA)

This Recombinant Quinol oxidase subunit 2 (qoxA) spans the amino acid sequence from region 29-291.

Product Specifications

Product Name Alternative

Quinol oxidase subunit 2, EC= 1.10.3.-, Cytochrome aa (3) subunit 2, Quinol oxidase polypeptide II

UniProt

Q81V01

Expression Region

29-291

Origin

Bacillus anthracis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LAVLNPQGPVAKAQYDLIVWSFLLMSLIIAIVFILFTVILIRYREKPENMDYEPPEQHGN TLLEIIWTLVPVIIVIALSIPTVKATYASEEVPKESKHIKPVEIYVTSANWKWLFSYPEE KIETVNYLNIPAGVPIQFKLTSVGPMNAFWVPELGGMKYTMDGMIMDLYLQADKPGSYLG RSANFSGEGFTHMEFEVEAKTKEKYDKWVKEVQQTAPKLTEDKYNEIVKPGVVGRMTFSS HHLSYVDPKSLEYCDYNYYKNKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDGF-B (F-3) Alexa Fluor® 790
sc-365805 AF790 200 µg/mL

PDGF-B (F-3) Alexa Fluor® 790

Sign In for Pricing
View Details
Monkey Abscisic Acid 8'-Hydroxylase 1 (ABA8OX1) ELISA Kit
MBS9399164-01 48 Well

Monkey Abscisic Acid 8'-Hydroxylase 1 (ABA8OX1) ELISA Kit

Sign In for Pricing
View Details
Monkey Abscisic Acid 8'-Hydroxylase 1 (ABA8OX1) ELISA Kit
MBS9399164-02 96 Well

Monkey Abscisic Acid 8'-Hydroxylase 1 (ABA8OX1) ELISA Kit

Sign In for Pricing
View Details
Monkey Abscisic Acid 8'-Hydroxylase 1 (ABA8OX1) ELISA Kit
MBS9399164-03 5x 96 Well

Monkey Abscisic Acid 8'-Hydroxylase 1 (ABA8OX1) ELISA Kit

Sign In for Pricing
View Details
Monkey Abscisic Acid 8'-Hydroxylase 1 (ABA8OX1) ELISA Kit
MBS9399164-04 10x 96 Well

Monkey Abscisic Acid 8'-Hydroxylase 1 (ABA8OX1) ELISA Kit

Sign In for Pricing
View Details
EUROSTAR 20 digital Overhead Stirrer
STI2888 1 Each

EUROSTAR 20 digital Overhead Stirrer

Sign In for Pricing
View Details