Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Quinol oxidase subunit 2 (qoxA)

This Recombinant Quinol oxidase subunit 2 (qoxA) spans the amino acid sequence from region 29-291.

Product Specifications

Product Name Alternative

Quinol oxidase subunit 2, EC= 1.10.3.-, Cytochrome aa (3) subunit 2, Quinol oxidase polypeptide II

UniProt

Q81V01

Expression Region

29-291

Origin

Bacillus anthracis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LAVLNPQGPVAKAQYDLIVWSFLLMSLIIAIVFILFTVILIRYREKPENMDYEPPEQHGN TLLEIIWTLVPVIIVIALSIPTVKATYASEEVPKESKHIKPVEIYVTSANWKWLFSYPEE KIETVNYLNIPAGVPIQFKLTSVGPMNAFWVPELGGMKYTMDGMIMDLYLQADKPGSYLG RSANFSGEGFTHMEFEVEAKTKEKYDKWVKEVQQTAPKLTEDKYNEIVKPGVVGRMTFSS HHLSYVDPKSLEYCDYNYYKNKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP8 Human siRNA Oligo Duplex (Locus ID 4317)
SR302928 1 Kit

MMP8 Human siRNA Oligo Duplex (Locus ID 4317)

Sign In for Pricing
View Details
Thalidomide-piperazine- (S) -CH2-pyrrolidine-C2-O-CH2-COO-C (CH3) 3
T208948-01 10 mg

Thalidomide-piperazine- (S) -CH2-pyrrolidine-C2-O-CH2-COO-C (CH3) 3

Sign In for Pricing
View Details
Thalidomide-piperazine- (S) -CH2-pyrrolidine-C2-O-CH2-COO-C (CH3) 3
T208948-02 50 mg

Thalidomide-piperazine- (S) -CH2-pyrrolidine-C2-O-CH2-COO-C (CH3) 3

Sign In for Pricing
View Details
CD163 Antibody
R30974 100 µg

CD163 Antibody

Sign In for Pricing
View Details
G2A HDR Plasmid (m)
sc-425258-HDR 20 µg

G2A HDR Plasmid (m)

Sign In for Pricing
View Details
AREG ELISA Kit (Human)
OKCD05603-96W 96 Well

AREG ELISA Kit (Human)

Sign In for Pricing
View Details