Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Quinol oxidase subunit 2 (qoxA)

This Recombinant Quinol oxidase subunit 2 (qoxA) spans the amino acid sequence from region 29-291.

Product Specifications

Product Name Alternative

Quinol oxidase subunit 2, EC= 1.10.3.-, Cytochrome aa (3) subunit 2, Quinol oxidase polypeptide II

UniProt

Q81V01

Expression Region

29-291

Origin

Bacillus anthracis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LAVLNPQGPVAKAQYDLIVWSFLLMSLIIAIVFILFTVILIRYREKPENMDYEPPEQHGN TLLEIIWTLVPVIIVIALSIPTVKATYASEEVPKESKHIKPVEIYVTSANWKWLFSYPEE KIETVNYLNIPAGVPIQFKLTSVGPMNAFWVPELGGMKYTMDGMIMDLYLQADKPGSYLG RSANFSGEGFTHMEFEVEAKTKEKYDKWVKEVQQTAPKLTEDKYNEIVKPGVVGRMTFSS HHLSYVDPKSLEYCDYNYYKNKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR5AN1 Antibody (C-term)
E45R14215G-4 50 µL

OR5AN1 Antibody (C-term)

Sign In for Pricing
View Details
OR5D16 Rabbit Polyclonal Antibody
TA316419 100 µL

OR5D16 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Olr774 ORF Vector (Rat) (pORF)
ORF072774 1.0 µg DNA

Olr774 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Ms4a6c (NM_001166376) Mouse Tagged Lenti ORF Clone
MR200574L3 10 µg

Ms4a6c (NM_001166376) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Alpha Taxilin/TXLNA Rabbit Polyclonal Antibody (Carrier-free)
orb3103204 100 µg

Alpha Taxilin/TXLNA Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
WRB siRNA (Mouse)
MBS827606-01 15 nmol

WRB siRNA (Mouse)

Sign In for Pricing
View Details