Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus Quinol oxidase subunit 2 (qoxA)

This Recombinant Bacillus cereus Quinol oxidase subunit 2 (qoxA) spans the amino acid sequence from region 29-291.

Product Specifications

Product Name Alternative

Quinol oxidase subunit 2, EC= 1.10.3.-, Cytochrome aa (3) subunit 2, Quinol oxidase polypeptide II

UniProt

Q81HT3

Expression Region

29-291

Origin

Bacillus cereus (strain ATCC 14579 / DSM 31)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LAVLNPQGPVAKAQYDLIVWSFLLMSLIIAIVFILFTVILIRYREKPENMDYEPPEQHGN TLLEIIWTLVPVIIVIALSIPTVKATYASEEVPKESKHIKPVEIYVTSANWKWLFSYPEE KIETVNYLNIPAGVPIQFKLTSVGPMNAFWVPELGGMKYTMDGMIMDLYLQADKPGSYLG RSANFSGEGFTHMEFEVEAKTKEKYDKWVKEVQETAPKLTEAKYNEIVKPGVVGRMTFSS HHLSYVDPKSLEYCDYNYYKNKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL
BNC940391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF594 conjugate, 0.1mg/mL
BNC940965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2597), CF594 conjugate, 0.1mg/mL
BNC942597-100 1x 100 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2597), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (rIGHG4/1345), CF488A conjugate, 0.1mg/mL
BNC882284-500 1x 500 µL

Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (rIGHG4/1345), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11), CF770 conjugate, 0.1mg/mL
BNC700470-500 1x 500 µL

CD45 / LCA (2B11), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1564R), CF405S conjugate, 0.1mg/mL
BNC041564-100 1x 100 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1564R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details