Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Integral membrane protein 2A (ITM2A)

This Recombinant Human Integral membrane protein 2A (ITM2A) spans the amino acid sequence from region 1-263.

Product Specifications

Product Name Alternative

Integral membrane protein 2A, Protein E25

UniProt

O43736

Expression Region

1-263

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVKIAFNTPTAVQKEEARQDVEALLSRTVRTQILTGKELRVATQEKEGSSGRCMLTLLGL SFILAGLIVGGACIYKYFMPKSTIYRGEMCFFDSEDPANSLRGGEPNFLPVTEEADIRED DNIAIIDVPVPSFSDSDPAAIIHDFEKGMTAYLDLLLGNCYLMPLNTSIVMPPKNLVELF GKLASGRYLPQTYVVREDLVAVEEIRDVSNLGIFIYQLCNNRKSFRLRRRDLLLGFNKRA IDKCWKIRHFPNEFIVETKICQE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX50 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4F7]
TA811893AM 100 µL

DDX50 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4F7]

Sign In for Pricing
View Details
LIM Kinase 1 (LIMK1) (NM_002314) Human Over-expression Lysate
LY400838 100 µg

LIM Kinase 1 (LIMK1) (NM_002314) Human Over-expression Lysate

Sign In for Pricing
View Details
EEF1A2 (NM_001958) Human Over-expression Lysate
LC419596 20 µg

EEF1A2 (NM_001958) Human Over-expression Lysate

Sign In for Pricing
View Details
Phosphotyrosine (PY20), CF594 conjugate, 0.1mg/mL
BNC940232-100 1x 100 µL

Phosphotyrosine (PY20), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nucleophosmin (Acute Myeloid Leukemia Marker) (NA24), 0.2mg/mL
BNUB2053-500 1x 500 µL

Nucleophosmin (Acute Myeloid Leukemia Marker) (NA24), 0.2mg/mL

Sign In for Pricing
View Details
Human MOBKL2B (MOB3B) activation kit by CRISPRa
GA112649 1 Kit

Human MOBKL2B (MOB3B) activation kit by CRISPRa

Sign In for Pricing
View Details