Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida tropicalis Altered inheritance of mitochondria protein 36, mitochondrial (AIM36)

This Recombinant Candida tropicalis Altered inheritance of mitochondria protein 36, mitochondrial (AIM36) spans the amino acid sequence from region 27-290.

Product Specifications

Product Name Alternative

Altered inheritance of mitochondria protein 36, mitochondrial, Found in mitochondria protein 39

UniProt

C5M696

Expression Region

27-290

Origin

Candida tropicalis (strain ATCC MYA-3404 / T1) (Yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YSSFLNQSPVNIIKRNYVIIHKQRKKEPVLRYLFYMIVLSWGFIYYVANRVDKKTVKKDF SEREFQQYEEATGVKRRNKLISGDLSSKYKFYVIPYINDNEQLDKIVNLLKSKDEGTHVK IIDPSELIEQQKQDEGLRYHYLLHDLEEQKRPYPQGLITALVKQEINNYSNTRQGTFETN FIIKNYPQTTAEAIKFENDVADVQKCLILHFDMLNELPKYKNEEEQRAIQNVDGYFDSVG RAKTLIDKFDPMDEEFEEIMMEDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL
BNC740146-500 1x 500 µL

CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF640R conjugate, 0.1mg/mL
BNC400175-500 1x 500 µL

CD46 (122.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL
BNC471081-500 1x 500 µL

CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL
BNC040352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF640R conjugate, 0.1mg/mL
BNC400861-100 1x 100 µL

HSP27 (G3.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL
BNC940352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details