Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Uncharacterized protein C737.05 (SPCC737.05)

This Recombinant Schizosaccharomyces pombe Uncharacterized protein C737.05 (SPCC737.05) spans the amino acid sequence from region 1-264.

Product Specifications

Product Name Alternative

Uncharacterized protein C737.05

UniProt

O13679

Expression Region

1-264

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQNELNPILLSQNSIRFATRVAIFFIIRDELVEAVTWRHPVKSMCLGLTITLLYLHPVSF SAILLLVFLTMMPISMTHDVTTNLKDLQNFMASYSSSYDQLLYFRQNYYHHITPSAISSG LLVSLVLIFLLAYLRISIDRYLPIAIWIGLISLHPKLRSYLIQFYSAKRDHVPYLQIRNE LAQVWRHVDISGSQTTTRYTSFPKFNPENSVTSLDLVEPPENYSWAPQSDWTFVPPNEFR RFILWSPQPPKMNRKSSHGSNLPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL
BNC680204-500 1x 500 µL

Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF647 conjugate, 0.1mg/mL
BNC470032-100 1x 100 µL

MUC2 (CCP58), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1815R), CF647 conjugate, 0.1mg/mL
BNC471815-500 1x 500 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1815R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2488R), CF594 conjugate, 0.1mg/mL
BNC942488-500 1x 500 µL

TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2488R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (C68/2908R), CF568 conjugate, 0.1mg/mL
BNC682908-500 1x 500 µL

CD68 (Macrophage Marker) (C68/2908R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2051), CF405S conjugate, 0.1mg/mL
BNC042051-100 1x 100 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2051), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details