Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leucine-rich repeat-containing protein 55 (LRRC55)

This Recombinant Human Leucine-rich repeat-containing protein 55 (LRRC55) spans the amino acid sequence from region 48-311.

Product Specifications

Product Name Alternative

Leucine-rich repeat-containing protein 55

UniProt

Q6ZSA7

Expression Region

48-311

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GTSCPVLCTCRNQVVDCSSQRLFSVPPDLPMDTRNLSLAHNRITAVPPGYLTCYMELQVL DLHNNSLMELPRGLFLHAKRLAHLDLSYNNFSHVPADMFQEAHGLVHIDLSHNPWLRRVH PQAFQGLMQLRDLDLSYGGLAFLSLEALEGLPGLVTLQIGGNPWVCGCTMEPLLKWLRNR IQRCTADSQLAECRGPPEVEGAPLFSLTEESFKACHLTLTLDDYLFIAFVGFVVSIASVA TNFLLGITANCCHRWSKASEEEEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Noggin/NOG Protein (aa 1-232, Fc Tag)
PKSH031721 100 µg

Recombinant Human Noggin/NOG Protein (aa 1-232, Fc Tag)

Sign In for Pricing
View Details
AccuClear® Ultra High Sensitivity dsDNA Quantitation Solution, Trial Size (200 assays)
#31027-T 1 Kit

AccuClear® Ultra High Sensitivity dsDNA Quantitation Solution, Trial Size (200 assays)

Sign In for Pricing
View Details
PE/Cyanine5.5 Armenian Hamster IgG Isotype Control[PIP]
E-AB-F09852I-01 20 Tests

PE/Cyanine5.5 Armenian Hamster IgG Isotype Control[PIP]

Sign In for Pricing
View Details
PE/Cyanine5.5 Armenian Hamster IgG Isotype Control[PIP]
E-AB-F09852I-02 100 Tests

PE/Cyanine5.5 Armenian Hamster IgG Isotype Control[PIP]

Sign In for Pricing
View Details
PE/Cyanine5.5 Armenian Hamster IgG Isotype Control[PIP]
E-AB-F09852I-03 2x 100 Tests

PE/Cyanine5.5 Armenian Hamster IgG Isotype Control[PIP]

Sign In for Pricing
View Details
IL17 (IL17A) (NM_002190) Human Recombinant Protein
TP318057L 1 mg

IL17 (IL17A) (NM_002190) Human Recombinant Protein

Sign In for Pricing
View Details