Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leucine-rich repeat-containing protein 55 (LRRC55)

This Recombinant Human Leucine-rich repeat-containing protein 55 (LRRC55) spans the amino acid sequence from region 48-311.

Product Specifications

Product Name Alternative

Leucine-rich repeat-containing protein 55

UniProt

Q6ZSA7

Expression Region

48-311

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GTSCPVLCTCRNQVVDCSSQRLFSVPPDLPMDTRNLSLAHNRITAVPPGYLTCYMELQVL DLHNNSLMELPRGLFLHAKRLAHLDLSYNNFSHVPADMFQEAHGLVHIDLSHNPWLRRVH PQAFQGLMQLRDLDLSYGGLAFLSLEALEGLPGLVTLQIGGNPWVCGCTMEPLLKWLRNR IQRCTADSQLAECRGPPEVEGAPLFSLTEESFKACHLTLTLDDYLFIAFVGFVVSIASVA TNFLLGITANCCHRWSKASEEEEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Netrin 1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-1858R-BF555-01 20 µL

Netrin 1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Netrin 1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-1858R-BF555-02 100 µL

Netrin 1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Anti-Dio-1 DIDO1 Antibody
A06019 100 µL

Anti-Dio-1 DIDO1 Antibody

Sign In for Pricing
View Details
IRX3 (Iroquois Homeobox 3, IRX-1) (FITC)
247725-FITC 100 µL

IRX3 (Iroquois Homeobox 3, IRX-1) (FITC)

Sign In for Pricing
View Details
TRNAK30 3'UTR GFP Stable Cell Line
TU076886 1.0 mL

TRNAK30 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mier3 (NM_172593) Mouse Untagged Clone
MC218883 10 µg

Mier3 (NM_172593) Mouse Untagged Clone

Sign In for Pricing
View Details