Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leucine-rich repeat-containing protein 55 (LRRC55)

This Recombinant Human Leucine-rich repeat-containing protein 55 (LRRC55) spans the amino acid sequence from region 48-311.

Product Specifications

Product Name Alternative

Leucine-rich repeat-containing protein 55

UniProt

Q6ZSA7

Expression Region

48-311

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GTSCPVLCTCRNQVVDCSSQRLFSVPPDLPMDTRNLSLAHNRITAVPPGYLTCYMELQVL DLHNNSLMELPRGLFLHAKRLAHLDLSYNNFSHVPADMFQEAHGLVHIDLSHNPWLRRVH PQAFQGLMQLRDLDLSYGGLAFLSLEALEGLPGLVTLQIGGNPWVCGCTMEPLLKWLRNR IQRCTADSQLAECRGPPEVEGAPLFSLTEESFKACHLTLTLDDYLFIAFVGFVVSIASVA TNFLLGITANCCHRWSKASEEEEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBFA2T2, NT (CBFA2T2, EHT, MTGR1, Protein CBFA2T2, ETO homologous on chromosome 20, MTG8-like protein, MTG8-related protein 1, Myeloid translocation-related protein 1, p85) (PE)
MBS6281111-01 0.2 mL

CBFA2T2, NT (CBFA2T2, EHT, MTGR1, Protein CBFA2T2, ETO homologous on chromosome 20, MTG8-like protein, MTG8-related protein 1, Myeloid translocation-related protein 1, p85) (PE)

Sign In for Pricing
View Details
CBFA2T2, NT (CBFA2T2, EHT, MTGR1, Protein CBFA2T2, ETO homologous on chromosome 20, MTG8-like protein, MTG8-related protein 1, Myeloid translocation-related protein 1, p85) (PE)
MBS6281111-02 5x 0.2 mL

CBFA2T2, NT (CBFA2T2, EHT, MTGR1, Protein CBFA2T2, ETO homologous on chromosome 20, MTG8-like protein, MTG8-related protein 1, Myeloid translocation-related protein 1, p85) (PE)

Sign In for Pricing
View Details
Silver Nanoparticles Dispersion (Spherical) (AG60), 0.02mg/ml in Citrate (2mM)
58322-1 25 ml

Silver Nanoparticles Dispersion (Spherical) (AG60), 0.02mg/ml in Citrate (2mM)

Sign In for Pricing
View Details
AU040320 Mouse shRNA Plasmid (Locus ID 100317)
TL505593 1 Kit

AU040320 Mouse shRNA Plasmid (Locus ID 100317)

Sign In for Pricing
View Details
JWH-073 (Indole-d7) Butanoic Acid
452939 1 mg

JWH-073 (Indole-d7) Butanoic Acid

Sign In for Pricing
View Details
Lithocholic acid
2187-1G 1 g

Lithocholic acid

Sign In for Pricing
View Details