Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Stage IV sporulation protein FA (spoIVFA)

This Recombinant Bacillus subtilis Stage IV sporulation protein FA (spoIVFA) spans the amino acid sequence from region 1-264.

Product Specifications

Product Name Alternative

Stage IV sporulation protein FA

UniProt

P26936

Expression Region

1-264

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSHRADEIRKRLEKRRKQLSGSKRFSTQTVSEKQKPPSWVMVTDQEKHGTLPVYEDNMPT FNGKHPLVKTDSIILKCLLSACLVLVSAIAYKTNIGPVSQIKPAVAKTFETEFQFASASH WFETKFGNPLAFLAPEHKNKEQQIEVGKDLIAPASGKVQQDFQDNGEGIKVETSSDKIDS VKEGYVVEVSKDSQTGLTVKVQHADNTYSIYGELKDVDVALYDFVDKGKKLGSIKLDDHN KGVYYFAMKDGDKFIDPIQVISFE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAR1 (ADAR) (NM_001111) Human Over-expression Lysate
LC420128 20 µg

ADAR1 (ADAR) (NM_001111) Human Over-expression Lysate

Sign In for Pricing
View Details
PDE1B (NM_001165975) Human Over-expression Lysate
LC431450 20 µg

PDE1B (NM_001165975) Human Over-expression Lysate

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD105 Antibody[SN6]
E-AB-F1310M-01 20 Tests

Elab Fluor® 647 Anti-Human CD105 Antibody[SN6]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD105 Antibody[SN6]
E-AB-F1310M-02 100 Tests

Elab Fluor® 647 Anti-Human CD105 Antibody[SN6]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD105 Antibody[SN6]
E-AB-F1310M-03 2x 100 Tests

Elab Fluor® 647 Anti-Human CD105 Antibody[SN6]

Sign In for Pricing
View Details
Tspan32 Mouse Gene Knockout Kit (CRISPR)
KN518358 1 Kit

Tspan32 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details