Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage PRD1 Transglycosylase (VII)

This Recombinant Enterobacteria phage PRD1 Transglycosylase (VII) spans the amino acid sequence from region 2-265.

Product Specifications

Product Name Alternative

Transglycosylase, EC= 4.2.2.-, Protein P7

UniProt

P27380

Expression Region

2-265

Origin

Enterobacteria phage PRD1 (Bacteriophage PRD1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SGALQWWETIGAASAQYNLDPRLVAGVVQTESSGNPRTTSGVGAMGLMQLMPATAKSLGV TNAYDPTQNIYGGAALLRENLDRYGDVNTALLAYHGGTNQANWGAKTKSYPGKVMKNINL LFGNSGPVVTPAAGIAPVSGAQEMTAVNISDYTAPDLTGLTMGAGSPDFTGGASGSWGEE NIPWYRVDKHVANAAGSAYDAVTDAVSAPVEAAGNYALRGVVIIAAVAIVVVGLYFLFQD EINSAAMKMIPAGKAAGAAAKALA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmel17 / gp100 / SILV (NKI-beteb), CF568 conjugate, 0.1mg/mL
BNC680226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL
BNC040031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL
BNC040437-100 1x 100 µL

CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MZ2E/838), CF488A conjugate, 0.1mg/mL
BNC880838-500 1x 500 µL

MAGE A1 (MZ2E/838), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 4 (KRT4) (KRT4/2804), CF640R conjugate, 0.1mg/mL
BNC402804-100 1x 100 µL

Cytokeratin 4 (KRT4) (KRT4/2804), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (CA72/733), CF647 conjugate, 0.1mg/mL
BNC470733-100 1x 100 µL

TAG-72 / CA72.4 (CA72/733), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details