Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Neurospora crassa Mitochondrial intermembrane space import and assembly protein 40 (mia-40)

This Recombinant Neurospora crassa Mitochondrial intermembrane space import and assembly protein 40 (mia-40) spans the amino acid sequence from region 34-298.

Product Specifications

Product Name Alternative

Mitochondrial intermembrane space import and assembly protein 40, Mitochondrial import inner membrane translocase TIM40

UniProt

Q7S3S2

Expression Region

34-298

Origin

Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ASTTSAPKKKSTWKGAAVRWGLAVAAVYYYNTSPIFSDELPETAGTAPSQLTDADLPTVD AIVEEKRRQAAEHAAARKAAQAAAKAAATPATPSESVEEQITKAEAEAEAVPEGDSKPRS ESTEGVIPEAGASPEALQEEADAQGAFNPETGEINWDCPCLGGMAHGPCGEEFKAAFSCF VYSTEEPKGMDCIEKFSHMQDCFRKYPEVYGAELADDEEAERASAAAPAAEGTPAKEEPV ENKKEEALEPATHDATAANNNKKQQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL
BNC470391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
BNC880525-100 1x 100 µL

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL
BNC470965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
BNC681820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calponin-1 (Smooth Muscle Marker) (CNN1/1408R), CF640R conjugate, 0.1mg/mL
BNC401408-100 1x 100 µL

Calponin-1 (Smooth Muscle Marker) (CNN1/1408R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (KP1), CF568 conjugate, 0.1mg/mL
BNC680512-500 1x 500 µL

CD68 (KP1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details