Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlorella vulgaris Chloroplast envelope membrane protein (cemA)

This Recombinant Chlorella vulgaris Chloroplast envelope membrane protein (cemA) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

Chloroplast envelope membrane protein

UniProt

P56349

Expression Region

1-266

Origin

Chlorella vulgaris (Green alga)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKRTREQTGLIPRSILRTFERFRKQLLPGAEMLVIQEFRISRYQVIVSVRCLITLIFVP LFINILSKSFLIRPGIEYLWNQNHNEIFLNSYQENRALHDLHQFEEKVYFDSFVTDFAPS SNVLLQKQSVEIAKNYNLESIEAISNLFADFLSFLSLSVVFLLLKPQIIILKAFLSESLY SLSDTTKSFLLILGTDLLVGFHSPRGWEVFLEWLLRHFGLPENSDFMSLFVATFPVFLDT VFKYWIFRSLNKISPSTVATYHNIIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD104 (UM-A9), CF488A conjugate, 0.1mg/mL
BNC880449-100 1x 100 µL

CD104 (UM-A9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL
BNC470437-500 1x 500 µL

CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
BNC880026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF594 conjugate, 0.1mg/mL
BNC940189-100 1x 100 µL

CD74 (BU45), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF594 conjugate, 0.1mg/mL
BNC940218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD269 / TNFRSF17 / BCMA (B-Cell Maturation Protein) (BCMA/2366), CF594 conjugate, 0.1mg/mL
BNC942366-500 1x 500 µL

CD269 / TNFRSF17 / BCMA (B-Cell Maturation Protein) (BCMA/2366), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details